PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma106g00550.1
Common NameZOSMA_106G00550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 573aa    MW: 63349.3 Da    PI: 6.3566
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma106g00550.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-093363731954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   n+yps  ++  LA+++gL+ +qV++WF N R +
  Zosma106g00550.1 336 FEHflNPYPSDVDKHILARQTGLSRSQVSNWFINARVR 373
                       665569******************************88 PP

2BELL100.31.5e-32199267472
              BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       +lq++ka+L  +leeV+ r+k+y +q+++vi+sF++v+g+gs+++Yt+lA ka+S+hFrcL+d i++qi
  Zosma106g00550.1 199 DLQRRKARLFAMLEEVNMRFKKYSDQMKAVINSFDTVVGVGSSEVYTTLATKAMSKHFRCLRDGIVGQI 267
                       79*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.8E-38108265IPR006563POX domain
PfamPF075266.8E-40115263IPR006563POX domain
PROSITE profilePS5007112.568314377IPR001356Homeobox domain
SMARTSM003896.2E-9317381IPR001356Homeobox domain
CDDcd000864.23E-12317378No hitNo description
SuperFamilySSF466891.41E-17318384IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-27320383IPR009057Homeodomain-like
PfamPF059206.7E-18334373IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MQSYGRNTDL YGLQTGMEML GMAAAASNSK NEAQYYQQQQ NQQQSGTSSE FNNGIFVDDS  60
SLRCLFPTQP LSLSLCNSIP TPNMVNYQHQ NQNQQQDHQD GVFINMPQGF YDQQLKSSRY  120
LIPTQELLRE FCDILSSSGL NQKMIMKKKK DNNNNNNGGG GGGGNQWVEG GCSSSSSSSW  180
NHYNTQQQQA LLQSLDILDL QRRKARLFAM LEEVNMRFKK YSDQMKAVIN SFDTVVGVGS  240
SEVYTTLATK AMSKHFRCLR DGIVGQIKIT KKIMGEKDAI APGSSRGETP RLKLLDQCIR  300
QQKAFQQGGG VIDNQPWRPQ RGLPERSVSI LRAWLFEHFL NPYPSDVDKH ILARQTGLSR  360
SQVSNWFINA RVRLWKPMVE EMYVEETKEE DVRDITAGFD HSGNSTGVGV ISGASGGCDI  420
GGGGFSVAST NPTLEDQKPD YDSLFSVVNG TSNYNREHNN YQFPNDCWSY GAGNGSSSTT  480
TGTGGGFGNG VSLTLGLKQH NDNIQFGPPD PSLFFQRSSD AEQLEPPQIG QQFTTGVVNM  540
DQGGDVGDER QNLQIPYRNM MGGAQLLHDL TR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A4e-15323380158Homeobox protein Meis1
4xrs_B4e-15323380158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919091.11e-147PREDICTED: homeobox protein BEL1 homolog
RefseqXP_010919093.11e-147PREDICTED: homeobox protein BEL1 homolog
RefseqXP_010919094.11e-147PREDICTED: homeobox protein BEL1 homolog
TrEMBLA0A0K9Q4R00.0A0A0K9Q4R0_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38143764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.17e-84TALE family protein